General Information

  • ID:  hor006454
  • Uniprot ID:  Q25588
  • Protein name:  CHH precursor-related peptide A*
  • Gene name:  CHHA*
  • Organism:  Faxonius limosus (Spinycheek crayfish) (Orconectes limosus)
  • Family:  Arthropod CHH/MIH/GIH/VIH hormone family
  • Source:  animal
  • Expression:  Produced by the medulla terminalis X-organ in the eyestalks and transported to the sinus gland where they are stored and released.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Faxonius (genus), Cambarinae (subfamily), Cambaridae (family), Astacoidea (superfamily), Astacidea (infraorder), Pleocyemata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea , Mandibulata , Arthropoda (phylum), Panarthropoda , Ecdysozoa , Protostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0005975 carbohydrate metabolic process; GO:0006006 glucose metabolic process; GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  RSVEGSSRMERLLSSGSSSSEPLSFLSQDQSVN
  • Length:  33
  • Propeptide:  MVSFRTMWSVVVVVVVASLASSGVQGRSVEGSSRMERLLSSGSSSSEPLSFLSQDQSVNKRQVFDQACKGIYDRAIFKKLDRVCEDCYNLYRKPYVATTCRQNCYANSVFRQCLDDLLLIDVLDEYISGVQTVGK
  • Signal peptide:  MVSFRTMWSVVVVVVVASLASSGVQG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Hormone found in the sinus gland of isopods and decapods which controls the blood sugar level. Has a secretagogue action over the amylase released from the midgut gland. May act as a stress hormone and may be involved in the control of molting and reproduction.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q25588-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006454_AF2.pdbhor006454_ESM.pdb

Physical Information

Mass: 411571 Formula: C144H239N45O57S
Absent amino acids: ACHIKTWY Common amino acids: S
pI: 4.59 Basic residues: 3
Polar residues: 15 Hydrophobic residues: 7
Hydrophobicity: -65.76 Boman Index: -9746
Half-Life: 1 hour Half-Life Yeast: 2 min
Half-Life E.Coli: 2 min Aliphatic Index 64.85
Instability Index: 9469.09 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  7925379
  • Title:  Cloning and expression of two crustacean hyperglycemic-hormone mRNAs in the eyestalk of the crayfish Orconectes limosus.
  • PubMed ID:  1788131
  • Title:  Isolation and amino acid sequence of crustacean hyperglycemic hormone precursor-related peptides.
  • PubMed ID:  1800954
  • Title:  Amino acid sequence of crustacean hyperglycemic hormone (CHH) from the crayfish, Orconectes limosus: emergence of a novel neuropeptide family.